SCOPe 2.07: Domain d1v76b_: 1v76 B:

Lineage for d1v76b_ (1v76 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.137: Rof/RNase P subunit-like [101743] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.137.1: Rof/RNase P subunit-like [101744] (2 families)

5. Family b.137.1.1: RNase P subunit p29-like [101745] (3 proteins)
   two available NMR structures display similar topologies but different barrel shapes
   the barrel shape of the full-length X-ray structures of AF1917 differs from both earlier NMR structures
   automatically mapped to Pfam PF01868

6. Protein Hypothetical protein PH1771 [117186] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [117187] (1 PDB entry)
   Uniprot O59425

8. Domain d1v76b_: 1v76 B: [113557]
   complexed with so4

Details for d1v76b_

PDB Entry: 1v76, 2 Å

PDB Description: crystal structure of archaeal ribonuclease p protein ph1771p from pyrococcus horikoshii ot3

PDB Compounds: (B:) RNase P protein Ph1771p

SCOPe Domain Sequences for d1v76b_:

Sequence; same for both SEQRES and ATOM records:

>d1v76b_ b.137.1.1 (B:) Hypothetical protein PH1771 {Pyrococcus horikoshii [TaxId: 53953]}
rvtrrniiwheliglrvrivgsthpafvgiegyvidetrnmlviagdriwkvpkdvsife
feaddgtkikipgerlvgrpemrlkkrwkkw

Timeline for d1v76b_:

• d1v76b_ first appeared in SCOP 1.71
  
• d1v76b_ appears in SCOPe 2.06
  
• d1v76b_ appears in the current release, SCOPe 2.08