Lineage for d1v4na1 (1v4n A:7-271)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887829Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 2887896Species Sulfolobus tokodaii [TaxId:111955] [117657] (1 PDB entry)
    Uniprot Q975C3
  8. 2887897Domain d1v4na1: 1v4n A:7-271 [113530]
    Other proteins in same PDB: d1v4na2, d1v4nb2
    structural genomics target

Details for d1v4na1

PDB Entry: 1v4n (more details), 2.45 Å

PDB Description: Structure of 5'-deoxy-5'-methylthioadenosine phosphorylase homologue from Sulfolobus tokodaii
PDB Compounds: (A:) 271aa long hypothetical 5'-methylthioadenosine phosphorylase

SCOPe Domain Sequences for d1v4na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4na1 c.56.2.1 (A:7-271) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus tokodaii [TaxId: 111955]}
ekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprhgrghri
pphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrtytffdg
ptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivwkevfka
diigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakvkkllye
virrlpekpderkcsccqalktalv

SCOPe Domain Coordinates for d1v4na1:

Click to download the PDB-style file with coordinates for d1v4na1.
(The format of our PDB-style files is described here.)

Timeline for d1v4na1: