Lineage for d1v40d1 (1v40 D:676-799)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089642Protein Class sigma GST [81351] (5 species)
  7. 1089655Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 1089671Domain d1v40d1: 1v40 D:676-799 [113518]
    Other proteins in same PDB: d1v40a2, d1v40b2, d1v40c2, d1v40d2
    complexed with gol, gsh, mg, o16

Details for d1v40d1

PDB Entry: 1v40 (more details), 1.9 Å

PDB Description: First Inhibitor Complex Structure of Human Hematopoietic Prostaglandin D Synthase
PDB Compounds: (D:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d1v40d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v40d1 a.45.1.1 (D:676-799) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d1v40d1:

Click to download the PDB-style file with coordinates for d1v40d1.
(The format of our PDB-style files is described here.)

Timeline for d1v40d1: