SCOPe 2.06: Domain d1v40b1: 1v40 B:276-399

Lineage for d1v40b1 (1v40 B:276-399)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (7 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d1v40b1: 1v40 B:276-399 [113514]
   Other proteins in same PDB: d1v40a2, d1v40b2, d1v40c2, d1v40d2
   complexed with gol, gsh, mg, o16

Details for d1v40b1

PDB Entry: 1v40, 1.9 Å

PDB Description: First Inhibitor Complex Structure of Human Hematopoietic Prostaglandin D Synthase

PDB Compounds: (B:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d1v40b1:

Sequence; same for both SEQRES and ATOM records:

>d1v40b1 a.45.1.1 (B:276-399) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d1v40b1:

• d1v40b1 first appeared in SCOP 1.71
  
• d1v40b1 appears in SCOPe 2.05
  
• d1v40b1 appears in SCOPe 2.07
  
• d1v40b1 appears in the current release, SCOPe 2.08