Lineage for d1v3za_ (1v3z A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724932Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (2 families) (S)
  5. 724933Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins)
  6. 724934Protein Acylphosphatase [54977] (4 species)
  7. 724939Species Pyrococcus horikoshii [TaxId:53953] [110973] (2 PDB entries)
  8. 724942Domain d1v3za_: 1v3z A: [113510]

Details for d1v3za_

PDB Entry: 1v3z (more details), 1.72 Å

PDB Description: Crystal Structure of Acylphosphatase from Pyrococcus horikoshii
PDB Compounds: (A:) acylphosphatase

SCOP Domain Sequences for d1v3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3za_ d.58.10.1 (A:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfrivg

SCOP Domain Coordinates for d1v3za_:

Click to download the PDB-style file with coordinates for d1v3za_.
(The format of our PDB-style files is described here.)

Timeline for d1v3za_: