Lineage for d1v3za_ (1v3z A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953324Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2953325Protein Acylphosphatase [54977] (4 species)
  7. 2953330Species Pyrococcus horikoshii [TaxId:53953] [110973] (2 PDB entries)
    Uniprot P84142
  8. 2953331Domain d1v3za_: 1v3z A: [113510]
    complexed with cl, k

Details for d1v3za_

PDB Entry: 1v3z (more details), 1.72 Å

PDB Description: Crystal Structure of Acylphosphatase from Pyrococcus horikoshii
PDB Compounds: (A:) acylphosphatase

SCOPe Domain Sequences for d1v3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3za_ d.58.10.1 (A:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfrivg

SCOPe Domain Coordinates for d1v3za_:

Click to download the PDB-style file with coordinates for d1v3za_.
(The format of our PDB-style files is described here.)

Timeline for d1v3za_: