Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species) there is an additional C-terminal allosteric domain in some species |
Species Thermotoga maritima [TaxId:2336] [102699] (3 PDB entries) Uniprot Q9X0D2 |
Domain d1usyf_: 1usy F: [113427] Other proteins in same PDB: d1usya_, d1usyb_, d1usyc_, d1usyd_ protein/RNA complex; complexed with his, po4 |
PDB Entry: 1usy (more details), 2.52 Å
SCOPe Domain Sequences for d1usyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usyf_ c.94.1.1 (F:) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Thermotoga maritima [TaxId: 2336]} mlklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadi gfcgtdvlleketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqrycesk gwhcriiplkgsvelapiaglsdlivditetgrtlkennleildeifvirthvvvnpvsy rtkreevvsfleklqeviehdsn
Timeline for d1usyf_: