Lineage for d1up3a_ (1up3 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110411Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2110412Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2110413Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2110451Protein Putative cellulase Rv0062 (Cel6, CelA1) [117447] (1 species)
  7. 2110452Species Mycobacterium tuberculosis [TaxId:1773] [117448] (4 PDB entries)
    Uniprot Q79G13 88-380
  8. 2110454Domain d1up3a_: 1up3 A: [113357]
    complexed with 1pg, so4

Details for d1up3a_

PDB Entry: 1up3 (more details), 1.6 Å

PDB Description: structure of the endoglucanase cel6 from mycobacterium tuberculosis in complex with methyl-cellobiosyl-4-deoxy-4-thio-beta-d-cellobioside at 1.6 angstrom
PDB Compounds: (A:) putative cellulase cel6

SCOPe Domain Sequences for d1up3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up3a_ c.6.1.1 (A:) Putative cellulase Rv0062 (Cel6, CelA1) {Mycobacterium tuberculosis [TaxId: 1773]}
anplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvggtvaryt
gaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspatiivepda
lamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarlndvgvgr
argfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwcnpsgral
gappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq

SCOPe Domain Coordinates for d1up3a_:

Click to download the PDB-style file with coordinates for d1up3a_.
(The format of our PDB-style files is described here.)

Timeline for d1up3a_: