Lineage for d1unle_ (1unl E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495405Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1495406Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)
  7. 1495407Species Human (Homo sapiens) [TaxId:9606] [74740] (5 PDB entries)
    Uniprot Q15078 145-294
  8. 1495411Domain d1unle_: 1unl E: [113327]
    Other proteins in same PDB: d1unla_, d1unlb_
    complexed with rrc

Details for d1unle_

PDB Entry: 1unl (more details), 2.2 Å

PDB Description: structural mechanism for the inhibition of cd5-p25 from the roscovitine, aloisine and indirubin.
PDB Compounds: (E:) Cyclin-dependent kinase 5 activator 1

SCOPe Domain Sequences for d1unle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unle_ a.74.1.1 (E:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]}
qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl
ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv
inlmsskmlqinadphyftqvfsdlknesg

SCOPe Domain Coordinates for d1unle_:

Click to download the PDB-style file with coordinates for d1unle_.
(The format of our PDB-style files is described here.)

Timeline for d1unle_: