SCOPe 2.04: Domain d1unhd_: 1unh D:

Lineage for d1unhd_ (1unh D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74740] (5 PDB entries)
   Uniprot Q15078 145-294

8. Domain d1unhd_: 1unh D: [113322]
   Other proteins in same PDB: d1unha_, d1unhb_
   complexed with ixm

Details for d1unhd_

PDB Entry: 1unh, 2.35 Å

PDB Description: structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.

PDB Compounds: (D:) Cyclin-dependent kinase 5 activator 1

SCOPe Domain Sequences for d1unhd_:

Sequence; same for both SEQRES and ATOM records:

>d1unhd_ a.74.1.1 (D:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]}
stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
lmsskmlqinadphyftqvfsdlknesg

Timeline for d1unhd_:

• d1unhd_ first appeared in SCOP 1.71
  
• d1unhd_ appears in SCOPe 2.03
  
• d1unhd_ appears in SCOPe 2.05
  
• d1unhd_ appears in the current release, SCOPe 2.08