Lineage for d1ujra1 (1ujr A:8-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009877Fold d.289: WWE domain [117838] (1 superfamily)
    beta(2)-alpha-beta(4); antiparallel folded beta-sheet (half-barrel), order 216543
  4. 3009878Superfamily d.289.1: WWE domain [117839] (1 family) (S)
  5. 3009879Family d.289.1.1: WWE domain [117840] (3 proteins)
    Pfam PF02825
  6. 3009884Protein RING finger protein 146 (Dactylidin) [117841] (1 species)
  7. 3009885Species Mouse (Mus musculus) [TaxId:10090] [117842] (1 PDB entry)
    Uniprot Q9CZW6 83-179
  8. 3009886Domain d1ujra1: 1ujr A:8-104 [113258]
    Other proteins in same PDB: d1ujra2, d1ujra3
    Structural genomics target

Details for d1ujra1

PDB Entry: 1ujr (more details)

PDB Description: solution structure of wwe domain in bab28015
PDB Compounds: (A:) hypothetical protein AK012080

SCOPe Domain Sequences for d1ujra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ujra1 d.289.1.1 (A:8-104) RING finger protein 146 (Dactylidin) {Mouse (Mus musculus) [TaxId: 10090]}
fldkptllspeelkaasrgngeyawyyegrngwwqydertsreledafskgkkntemlia
gflyvadlenmvqyrrnehgrrrkikrdiidipkkgv

SCOPe Domain Coordinates for d1ujra1:

Click to download the PDB-style file with coordinates for d1ujra1.
(The format of our PDB-style files is described here.)

Timeline for d1ujra1: