PDB entry 1ujr

View 1ujr on RCSB PDB site
Description: Solution structure of WWE domain in BAB28015
Class: structural genomics, unknown function
Keywords: NMR, WWE domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-08-11, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein AK012080
    Species: Mus musculus [TaxId:10090]
    Gene: AK012080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CZW6 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.08: d1ujra1, d1ujra2, d1ujra3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ujrA (A:)
pssgssgfldkptllspeelkaasrgngeyawyyegrngwwqydertsreledafskgkk
ntemliagflyvadlenmvqyrrnehgrrrkikrdiidipkkgvsgpssg