SCOPe 2.07: Domain d1u93a1: 1u93 A:1-107

Lineage for d1u93a1 (1u93 A:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (63 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d1u93a1: 1u93 A:1-107 [113224]
   Other proteins in same PDB: d1u93a2, d1u93b1, d1u93b2

Details for d1u93a1

PDB Entry: 1u93, 2.37 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide Analog EQDKW-[Dap]-S (cyclic)

PDB Compounds: (A:) antibody 2f5 (light chain)

SCOPe Domain Sequences for d1u93a1:

Sequence; same for both SEQRES and ATOM records:

>d1u93a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

Timeline for d1u93a1:

• d1u93a1 first appeared in SCOP 1.71
  
• d1u93a1 appears in SCOPe 2.06
  
• d1u93a1 appears in the current release, SCOPe 2.08