![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein CheY protein [52174] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [52175] (42 PDB entries) Uniprot P06143 |
![]() | Domain d1u8tc_: 1u8t C: [113194] complexed with so4 |
PDB Entry: 1u8t (more details), 1.5 Å
SCOPe Domain Sequences for d1u8tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8tc_ c.23.1.1 (C:) CheY protein {Escherichia coli [TaxId: 562]} adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln kifeklgm
Timeline for d1u8tc_: