Lineage for d1u8tc_ (1u8t C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. Protein CheY protein [52174] (6 species)
  7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. Domain d1u8tc_: 1u8t C: [113194]
    complexed with so4

Details for d1u8tc_

PDB Entry: 1u8t (more details), 1.5 Å

PDB Description: Crystal structure of CheY D13K Y106W alone and in complex with a FliM peptide
PDB Compounds: (C:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1u8tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8tc_ c.23.1.1 (C:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d1u8tc_ are not available.

Timeline for d1u8tc_:

Domains from other chains:
(mouse over for more information)
d1u8ta_, d1u8tb_, d1u8td_