PDB entry 1u8t

View 1u8t on RCSB PDB site
Description: Crystal structure of CheY D13K Y106W alone and in complex with a FliM peptide
Class: signaling protein
Keywords: CHEY, FLIM, (beta/alpha)5, SIGNALING PROTEIN
Deposited on 2004-08-06, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:562]
    Gene: cheY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-127)
      • engineered (11)
      • modified residue (15)
      • modified residue (58)
      • modified residue (61)
      • modified residue (76)
      • modified residue (83)
      • engineered (104)
      • modified residue (127)
    Domains in SCOPe 2.08: d1u8ta_
  • Chain 'B':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:562]
    Gene: cheY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-127)
      • engineered (11)
      • modified residue (15)
      • modified residue (58)
      • modified residue (61)
      • modified residue (76)
      • modified residue (83)
      • engineered (104)
      • modified residue (127)
    Domains in SCOPe 2.08: d1u8tb_
  • Chain 'C':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:562]
    Gene: cheY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-127)
      • engineered (11)
      • modified residue (15)
      • modified residue (58)
      • modified residue (61)
      • modified residue (76)
      • modified residue (83)
      • engineered (104)
      • modified residue (127)
    Domains in SCOPe 2.08: d1u8tc_
  • Chain 'D':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:562]
    Gene: cheY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-127)
      • engineered (11)
      • modified residue (15)
      • modified residue (58)
      • modified residue (61)
      • modified residue (76)
      • modified residue (83)
      • engineered (104)
      • modified residue (127)
    Domains in SCOPe 2.08: d1u8td_
  • Chain 'E':
    Compound: Flagellar motor switch protein fliM
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Flagellar motor switch protein fliM
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u8tA (A:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8tA (A:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifekm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8tB (B:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8tC (C:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8tD (D:)
    adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
    kifeklgm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.