SCOP 1.75: Domain d1u8rh1: 1u8r H:1-64

Lineage for d1u8rh1 (1u8r H:1-64)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Iron-dependent regulator IdeR [46885] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)
   Uniprot Q50495

8. Domain d1u8rh1: 1u8r H:1-64 [113183]
   Other proteins in same PDB: d1u8ra2, d1u8ra3, d1u8rb2, d1u8rb3, d1u8rc2, d1u8rc3, d1u8rd2, d1u8rd3, d1u8rg2, d1u8rg3, d1u8rh2, d1u8rh3, d1u8ri2, d1u8ri3, d1u8rj2, d1u8rj3

Details for d1u8rh1

PDB Entry: 1u8r, 2.75 Å

PDB Description: Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions

PDB Compounds: (H:) iron-dependent repressor ider

SCOP Domain Sequences for d1u8rh1:

Sequence; same for both SEQRES and ATOM records:

>d1u8rh1 a.4.5.24 (H:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel

Timeline for d1u8rh1:

• d1u8rh1 first appeared in SCOP 1.71
  
• d1u8rh1 appears in SCOP 1.73
  
• d1u8rh1 appears in SCOPe 2.01
  
• d1u8rh1 appears in the current release, SCOPe 2.08