Lineage for d1u8rc2 (1u8r C:65-141)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918737Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 918738Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 918739Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 918772Protein Iron-dependent regulator [47983] (1 species)
  7. 918773Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
    Uniprot Q50495
  8. 918790Domain d1u8rc2: 1u8r C:65-141 [113175]
    Other proteins in same PDB: d1u8ra1, d1u8ra3, d1u8rb1, d1u8rb3, d1u8rc1, d1u8rc3, d1u8rd1, d1u8rd3, d1u8rg1, d1u8rg3, d1u8rh1, d1u8rh3, d1u8ri1, d1u8ri3, d1u8rj1, d1u8rj3
    protein/DNA complex; complexed with co, na

Details for d1u8rc2

PDB Entry: 1u8r (more details), 2.75 Å

PDB Description: Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions
PDB Compounds: (C:) iron-dependent repressor ider

SCOPe Domain Sequences for d1u8rc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8rc2 a.76.1.1 (C:65-141) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipgldelgvg

SCOPe Domain Coordinates for d1u8rc2:

Click to download the PDB-style file with coordinates for d1u8rc2.
(The format of our PDB-style files is described here.)

Timeline for d1u8rc2: