Class a: All alpha proteins [46456] (284 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
Protein Iron-dependent regulator [47983] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries) Uniprot Q50495 |
Domain d1u8rc2: 1u8r C:65-141 [113175] Other proteins in same PDB: d1u8ra1, d1u8ra3, d1u8rb1, d1u8rb3, d1u8rc1, d1u8rc3, d1u8rd1, d1u8rd3, d1u8rg1, d1u8rg3, d1u8rh1, d1u8rh3, d1u8ri1, d1u8ri3, d1u8rj1, d1u8rj3 protein/DNA complex; complexed with co, na |
PDB Entry: 1u8r (more details), 2.75 Å
SCOPe Domain Sequences for d1u8rc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8rc2 a.76.1.1 (C:65-141) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]} tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt tspfgnpipgldelgvg
Timeline for d1u8rc2: