SCOPe 2.08: Domain d1u8qb2: 1u8q B:114-216

Lineage for d1u8qb2 (1u8q B:114-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1u8qb2: 1u8q B:114-216 [113167]
   Other proteins in same PDB: d1u8qa1, d1u8qa2, d1u8qb1

Details for d1u8qb2

PDB Entry: 1u8q, 2.24 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELEKWAS

PDB Compounds: (B:) antibody 2f5 (heavy chain)

SCOPe Domain Sequences for d1u8qb2:

Sequence, based on SEQRES records:

>d1u8qb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapsskstagaaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc

Sequence, based on observed residues (ATOM records):

>d1u8qb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapgaaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslqtytcnvnhkpsntkvdkrvepksc

Timeline for d1u8qb2:

• d1u8qb2 first appeared in SCOP 1.71
  
• d1u8qb2 appears in SCOPe 2.07