PDB entry 1u8q

View 1u8q on RCSB PDB site
Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELEKWAS
Class: immune system
Keywords: Fab complex, HIV-1 Neutralization, gp41 Peptide, IMMUNE SYSTEM
Deposited on 2004-08-06, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-05, with a file datestamp of 2009-12-31.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody 2f5 (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U8Q (0-213)
    Domains in SCOPe 2.07: d1u8qa1, d1u8qa2
  • Chain 'B':
    Compound: antibody 2f5 (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U8Q (0-234)
    Domains in SCOPe 2.07: d1u8qb1, d1u8qb2
  • Chain 'C':
    Compound: gp41 peptide
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U8Q (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u8qA (A:)
    alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
    rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyecevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u8qB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstagaaaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u8qB (B:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapgaaaalgclvkdyfpepvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslqtytcnvnhkpsntkvdkrvepksc
    

  • Chain 'C':
    No sequence available.