Lineage for d1u5pa2 (1u5p A:1772-1872)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985195Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985196Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 1985197Family a.7.1.1: Spectrin repeat [46967] (3 protein domains)
  6. 1985210Protein Spectrin alpha chain [46968] (3 species)
  7. 1985211Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
    Uniprot P07751 1662-1981
  8. 1985213Domain d1u5pa2: 1u5p A:1772-1872 [113047]
    repeats 15 and 16
    complexed with k, po4

Details for d1u5pa2

PDB Entry: 1u5p (more details), 2 Å

PDB Description: Crystal Structure of Repeats 15 and 16 of Chicken Brain Alpha Spectrin
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d1u5pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
hqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqgvldt
gkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrle

SCOPe Domain Coordinates for d1u5pa2:

Click to download the PDB-style file with coordinates for d1u5pa2.
(The format of our PDB-style files is described here.)

Timeline for d1u5pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u5pa1