Lineage for d1u5la_ (1u5l A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016146Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1016147Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1016148Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1016149Protein Prion protein domain [54100] (13 species)
  7. 1016195Species Red-eared slider turtle (Trachemys scripta) [TaxId:34903] [117767] (1 PDB entry)
    Uniprot Q9I9C0 141-248
  8. 1016196Domain d1u5la_: 1u5l A: [113042]

Details for d1u5la_

PDB Entry: 1u5l (more details)

PDB Description: solution structure of the turtle prion protein fragment (121-226)
PDB Compounds: (A:) prion protein

SCOPe Domain Sequences for d1u5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5la_ d.6.1.1 (A:) Prion protein domain {Red-eared slider turtle (Trachemys scripta) [TaxId: 34903]}
gsvvgglggyalgsamsgmrmnfdrpeerqwwnensnrypnqvyykeyndrsvpegrfvr
dcvnitvteykidpnenqnvtqvevrvmkqviqemcmqqyqqyqlas

SCOPe Domain Coordinates for d1u5la_:

Click to download the PDB-style file with coordinates for d1u5la_.
(The format of our PDB-style files is described here.)

Timeline for d1u5la_: