Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins) |
Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species) has different dimerisation mode |
Species Human (Homo sapiens) [TaxId:9606] [54133] (9 PDB entries) Uniprot P13501 25-91 |
Domain d1u4mb_: 1u4m B: [113020] complexed with acy, h3s |
PDB Entry: 1u4m (more details), 2 Å
SCOP Domain Sequences for d1u4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u4mb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]} ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin slems
Timeline for d1u4mb_: