SCOP 1.71: Domain d1u4mb_: 1u4m B:

Lineage for d1u4mb_ (1u4m B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.9: IL8-like [54116] (1 superfamily)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (9 PDB entries)

8. Domain d1u4mb_: 1u4m B: [113020]
   complexed with acy, h3s

Details for d1u4mb_

PDB Entry: 1u4m, 2 Å

PDB Description: human rantes complexed to heparin-derived disaccharide iii-s

SCOP Domain Sequences for d1u4mb_:

Sequence; same for both SEQRES and ATOM records:

>d1u4mb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

Timeline for d1u4mb_:

• d1u4mb_ is new in SCOP 1.71
  
• d1u4mb_ appears in SCOP 1.73
  
• d1u4mb_ appears in the current release, SCOPe 2.08