Lineage for d1u4mb_ (1u4m B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597802Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 597803Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 597804Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 597971Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
    has different dimerisation mode
  7. 597972Species Human (Homo sapiens) [TaxId:9606] [54133] (9 PDB entries)
  8. 597982Domain d1u4mb_: 1u4m B: [113020]
    complexed with acy, h3s

Details for d1u4mb_

PDB Entry: 1u4m (more details), 2 Å

PDB Description: human rantes complexed to heparin-derived disaccharide iii-s

SCOP Domain Sequences for d1u4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4mb_ d.9.1.1 (B:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)}
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

SCOP Domain Coordinates for d1u4mb_:

Click to download the PDB-style file with coordinates for d1u4mb_.
(The format of our PDB-style files is described here.)

Timeline for d1u4mb_: