Lineage for d1u2ve_ (1u2v E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735006Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 2735007Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 2735008Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 2735009Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)
  7. 2735010Species Cow (Bos taurus) [TaxId:9913] [69063] (5 PDB entries)
    Uniprot O15145 # 100% sequence identity
  8. 2735014Domain d1u2ve_: 1u2v E: [112994]
    Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2vd1, d1u2vd2, d1u2vf_, d1u2vg_
    complexed with adp, ca

Details for d1u2ve_

PDB Entry: 1u2v (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium
PDB Compounds: (E:) Arp2/3 complex 21kDa subunit

SCOPe Domain Sequences for d1u2ve_:

Sequence, based on SEQRES records: (download)

>d1u2ve_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

Sequence, based on observed residues (ATOM records): (download)

>d1u2ve_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpskwwtcfvkrqfmnksls

SCOPe Domain Coordinates for d1u2ve_:

Click to download the PDB-style file with coordinates for d1u2ve_.
(The format of our PDB-style files is described here.)

Timeline for d1u2ve_: