Lineage for d1u2vd1 (1u2v D:1-120)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943975Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1944058Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1944059Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 1944060Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 1944061Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 1944070Domain d1u2vd1: 1u2v D:1-120 [112992]
    Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2ve_, d1u2vf_, d1u2vg_
    complexed with adp, ca

Details for d1u2vd1

PDB Entry: 1u2v (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium
PDB Compounds: (D:) Arp2/3 complex 34kDa subunit

SCOPe Domain Sequences for d1u2vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2vd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

SCOPe Domain Coordinates for d1u2vd1:

Click to download the PDB-style file with coordinates for d1u2vd1.
(The format of our PDB-style files is described here.)

Timeline for d1u2vd1: