Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.198: Secretion chaperone-like [69634] (2 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) |
Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
Protein ARPC2 (34 kDa subunit) [69649] (1 species) duplication: tandem repeat of two domains of this fold |
Species Cow (Bos taurus) [TaxId:9913] [69650] (3 PDB entries) |
Domain d1u2vd1: 1u2v D:1-120 [112992] Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2ve_, d1u2vf_, d1u2vg_ |
PDB Entry: 1u2v (more details), 2.55 Å
SCOP Domain Sequences for d1u2vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2vd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus)} millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
Timeline for d1u2vd1: