SCOP 1.71: Domain d1u2vd1: 1u2v D:1-120

Lineage for d1u2vd1 (1u2v D:1-120)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)

6. Protein ARPC2 (34 kDa subunit) [69649] (1 species)
   duplication: tandem repeat of two domains of this fold

7. Species Cow (Bos taurus) [TaxId:9913] [69650] (3 PDB entries)

8. Domain d1u2vd1: 1u2v D:1-120 [112992]
   Other proteins in same PDB: d1u2va1, d1u2va2, d1u2vb1, d1u2vc_, d1u2ve_, d1u2vf_, d1u2vg_

Details for d1u2vd1

PDB Entry: 1u2v, 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ADP and calcium

SCOP Domain Sequences for d1u2vd1:

Sequence; same for both SEQRES and ATOM records:

>d1u2vd1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus)}
millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc

Timeline for d1u2vd1:

• d1u2vd1 is new in SCOP 1.71
  
• d1u2vd1 appears in SCOP 1.73
  
• d1u2vd1 appears in the current release, SCOPe 2.08