Lineage for d1u19a_ (1u19 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252282Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2252283Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2252485Family f.13.1.2: Rhodopsin-like [81320] (2 proteins)
    Individual TM segments have a number of kinks and distortions
  6. 2252486Protein Rhodopsin [56876] (1 species)
  7. 2252487Species Cow (Bos taurus) [TaxId:9913] [56877] (9 PDB entries)
    Uniprot P02699
  8. 2252496Domain d1u19a_: 1u19 A: [112953]
    complexed with hg, htg, hto, plm, ret, zn

Details for d1u19a_

PDB Entry: 1u19 (more details), 2.2 Å

PDB Description: crystal structure of bovine rhodopsin at 2.2 angstroms resolution
PDB Compounds: (A:) rhodopsin

SCOPe Domain Sequences for d1u19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa

SCOPe Domain Coordinates for d1u19a_:

Click to download the PDB-style file with coordinates for d1u19a_.
(The format of our PDB-style files is described here.)

Timeline for d1u19a_: