![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
![]() | Protein Aminoimidazole riboside kinase [117720] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [117721] (3 PDB entries) Uniprot Q8ZKR2 |
![]() | Domain d1tz6a_: 1tz6 A: [112862] complexed with acp, ais, k, mg |
PDB Entry: 1tz6 (more details), 2.7 Å
SCOPe Domain Sequences for d1tz6a_:
Sequence, based on SEQRES records: (download)
>d1tz6a_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} nkvwvigdasvdlvpekqnsylkcpggasanvgvcvarlggecgfigclgdddagrflrq vfqdngvdvtflrldadltsavlivnltadgersftylvhpgadtyvspqdlppfrqyew fyfssigltdrpareaclegarrmreaggyvlfdvnlrskmwgntdeipeliarsaalas ickvsadelcqlsgashwqdaryylrdlgcdttiislgadgallitaegefhfpaprvdv vdttgagdafvggllftlsrancwdhallaeaisnanacgamavtakgamtalpfpdqln tfls
>d1tz6a_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} nkvwvigdasvdlvpekqnsylkcpggasanvgvcvarlggecgfigclgdddagrflrq vfqdngvdvtflrldadltsavlivnsftylvhpgadtyvspqdlppfrqyewfyfssig ltdrpareaclegarrmreaggyvlfdvnlrskmwgntdeipeliarsaalasickvsad elcqlsgashwqdaryylrdlgcdttiislgadgallitaegefhfpaprvdvvdttgag dafvggllftlsrancwdhallaeaisnanacgamavtakgamtalpfpdqlntfls
Timeline for d1tz6a_: