PDB entry 1tz6

View 1tz6 on RCSB PDB site
Description: Crystal structure of aminoimidazole riboside kinase from Salmonella enterica complexed with aminoimidazole riboside and ATP analog
Class: transferase
Keywords: ribokinase fold, alpha/beta, TRANSFERASE
Deposited on 2004-07-09, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative sugar kinase
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: stm4066
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tz6a_
  • Chain 'B':
    Compound: putative sugar kinase
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: stm4066
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tz6b_
  • Heterogens: MG, K, ACP, AIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tz6A (A:)
    mgsshhhhhhssglvprgshmkamnkvwvigdasvdlvpekqnsylkcpggasanvgvcv
    arlggecgfigclgdddagrflrqvfqdngvdvtflrldadltsavlivnltadgersft
    ylvhpgadtyvspqdlppfrqyewfyfssigltdrpareaclegarrmreaggyvlfdvn
    lrskmwgntdeipeliarsaalasickvsadelcqlsgashwqdaryylrdlgcdttiis
    lgadgallitaegefhfpaprvdvvdttgagdafvggllftlsrancwdhallaeaisna
    nacgamavtakgamtalpfpdqlntflsshslaqamtvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz6A (A:)
    nkvwvigdasvdlvpekqnsylkcpggasanvgvcvarlggecgfigclgdddagrflrq
    vfqdngvdvtflrldadltsavlivnsftylvhpgadtyvspqdlppfrqyewfyfssig
    ltdrpareaclegarrmreaggyvlfdvnlrskmwgntdeipeliarsaalasickvsad
    elcqlsgashwqdaryylrdlgcdttiislgadgallitaegefhfpaprvdvvdttgag
    dafvggllftlsrancwdhallaeaisnanacgamavtakgamtalpfpdqlntfls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tz6B (B:)
    mgsshhhhhhssglvprgshmkamnkvwvigdasvdlvpekqnsylkcpggasanvgvcv
    arlggecgfigclgdddagrflrqvfqdngvdvtflrldadltsavlivnltadgersft
    ylvhpgadtyvspqdlppfrqyewfyfssigltdrpareaclegarrmreaggyvlfdvn
    lrskmwgntdeipeliarsaalasickvsadelcqlsgashwqdaryylrdlgcdttiis
    lgadgallitaegefhfpaprvdvvdttgagdafvggllftlsrancwdhallaeaisna
    nacgamavtakgamtalpfpdqlntflsshslaqamtvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz6B (B:)
    nkvwvigdasvdlvpekqnsylkcpggasanvgvcvarlggecgfigclgdddagrflrq
    vfqdngvdvtflrldadltsavlivnftylvhpgadtyvspqdlppfrqyewfyfssigl
    tdrpareaclegarrmreaggyvlfdvnlrskmwgntdeipeliarsaalasickvsade
    lcqlsgashwqdaryylrdlgcdttiislgadgallitaegefhfpaprvdvvdttgagd
    afvggllftlsrancwdhallaeaisnanacgamavtakgamtalpfpdqlntflss