| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) ![]() |
| Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
| Protein RNA polymerase subunit RPB10 [46926] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (27 PDB entries) Uniprot P22139; part of multichain biological unit |
| Domain d1twhj_: 1twh J: [112761] Other proteins in same PDB: d1twha_, d1twhb_, d1twhc1, d1twhc2, d1twhe1, d1twhe2, d1twhf_, d1twhh_, d1twhi1, d1twhi2, d1twhk_, d1twhl_ protein/RNA complex; complexed with atp, mn, zn |
PDB Entry: 1twh (more details), 3.4 Å
SCOPe Domain Sequences for d1twhj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twhj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lryn
Timeline for d1twhj_: