Lineage for d1twge1 (1twg E:1-143)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835443Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 835824Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 835825Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 835826Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 835827Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 835838Domain d1twge1: 1twg E:1-143 [112742]
    Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_
    complexed with ctp, mn, zn

Details for d1twge1

PDB Entry: 1twg (more details), 3.3 Å

PDB Description: RNA polymerase II complexed with CTP
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d1twge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twge1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

SCOP Domain Coordinates for d1twge1:

Click to download the PDB-style file with coordinates for d1twge1.
(The format of our PDB-style files is described here.)

Timeline for d1twge1: