SCOP 1.71: Domain d1twge1: 1twg E:1-143

Lineage for d1twge1 (1twg E:1-143)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (10 PDB entries)

8. Domain d1twge1: 1twg E:1-143 [112742]
   Other proteins in same PDB: d1twga_, d1twgb_, d1twgc1, d1twgc2, d1twge2, d1twgf_, d1twgh_, d1twgi1, d1twgi2, d1twgj_, d1twgk_, d1twgl_
   complexed with ctp, mn, zn

Details for d1twge1

PDB Entry: 1twg, 3.3 Å

PDB Description: RNA polymerase II complexed with CTP

SCOP Domain Sequences for d1twge1:

Sequence; same for both SEQRES and ATOM records:

>d1twge1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

Timeline for d1twge1:

• d1twge1 is new in SCOP 1.71
  
• d1twge1 appears in SCOP 1.73
  
• d1twge1 appears in the current release, SCOPe 2.08