SCOPe 2.08: Domain d1twbb_: 1twb B:

Lineage for d1twbb_ (1twb B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.136: SspB-like [101737] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.136.1: SspB-like [101738] (3 families)

5. Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
   automatically mapped to Pfam PF04386

6. Protein Stringent starvation protein B, SspB [101740] (2 species)
   a specificity-enhancing factor for the ClpXP proteolytic machine

7. Species Haemophilus influenzae [TaxId:727] [101742] (5 PDB entries)
   Uniprot P45206 5-110

8. Domain d1twbb_: 1twb B: [112710]
   disulfide crosslinked to an SsrA degradation tag, chains C and D

Details for d1twbb_

PDB Entry: 1twb, 1.9 Å

PDB Description: sspb disulfide crosslinked to an ssra degradation tag

PDB Compounds: (B:) Stringent starvation protein B homolog

SCOPe Domain Sequences for d1twbb_:

Sequence; same for both SEQRES and ATOM records:

>d1twbb_ b.136.1.1 (B:) Stringent starvation protein B, SspB {Haemophilus influenzae [TaxId: 727]}
sspkrpyllrayydwlvdnsftpylvvdatylgvnvpvecvkdgqivlnlsasatgnlql
tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd

Timeline for d1twbb_:

• d1twbb_ first appeared in SCOP 1.71
  
• d1twbb_ appears in SCOPe 2.07