PDB entry 1twb

View 1twb on RCSB PDB site
Description: SspB disulfide crosslinked to an ssrA degradation tag
Class: hydrolase
Keywords: adaptor, protease, AAA+, specificity factor, hydrolase
Deposited on 2004-06-30, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.235
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB, HI1440
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45206 (Start-109)
      • engineered (43)
    Domains in SCOPe 2.07: d1twba_
  • Chain 'B':
    Compound: Stringent starvation protein B homolog
    Species: Haemophilus influenzae [TaxId:727]
    Gene: SSPB, HI1440
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45206 (Start-109)
      • engineered (43)
    Domains in SCOPe 2.07: d1twbb_
  • Chain 'C':
    Compound: ssrA peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1TWB (0-7)
  • Chain 'D':
    Compound: ssrA peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1TWB (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twbA (A:)
    meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpvecvkdgqivlnlsasatg
    nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twbA (A:)
    sspkrpyllrayydwlvdnsftpylvvdatylgvnvpvecvkdgqivlnlsasatgnlql
    tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twbB (B:)
    meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpvecvkdgqivlnlsasatg
    nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twbB (B:)
    sspkrpyllrayydwlvdnsftpylvvdatylgvnvpvecvkdgqivlnlsasatgnlql
    tndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiyd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.