Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins) |
Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries) Uniprot P08037 131-402 |
Domain d1tw1b_: 1tw1 B: [112689] complexed with dio, gdu, mes, mg, so4; mutant |
PDB Entry: 1tw1 (more details), 2.3 Å
SCOPe Domain Sequences for d1tw1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tw1b_ c.68.1.2 (B:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm lsdglnsltymvlevqryplytkitvdigtps
Timeline for d1tw1b_: