PDB entry 1tw1

View 1tw1 on RCSB PDB site
Description: beta-1,4-galactosyltransferase mutant Met344His (m344H-Gal-T1) complex with UDP-galactose and magnesium
Class: transferase
Keywords: Met344His mutation; closed conformation; Mn binding, TRANSFERASE
Deposited on 2004-06-30, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-1,4-galactosyltransferase 1
    Species: Bos taurus [TaxId:9913]
    Gene: B4GALT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (225)
      • engineered (227)
    Domains in SCOPe 2.07: d1tw1a_
  • Chain 'B':
    Compound: Beta-1,4-galactosyltransferase 1
    Species: Bos taurus [TaxId:9913]
    Gene: B4GALT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08037 (Start-285)
      • engineered (225)
      • engineered (227)
    Domains in SCOPe 2.07: d1tw1b_
  • Heterogens: GDU, MG, SO4, DIO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tw1A (A:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw1A (A:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tw1B (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tw1B (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps