SCOPe 2.07: Domain d1tuyb1: 1tuy B:1-197

Lineage for d1tuyb1 (1tuy B:1-197)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.2: Acetokinase-like [53080] (4 proteins)

6. Protein Acetate kinase [53081] (1 species)

7. Species Methanosarcina thermophila [TaxId:2210] [53082] (3 PDB entries)
   Uniprot P38502 1-399

8. Domain d1tuyb1: 1tuy B:1-197 [112668]
   complexed with acy, adp, af3, so4

Details for d1tuyb1

PDB Entry: 1tuy, 3 Å

PDB Description: Acetate Kinase complexed with ADP, AlF3 and acetate

PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d1tuyb1:

Sequence; same for both SEQRES and ATOM records:

>d1tuyb1 c.55.1.2 (B:1-197) Acetate kinase {Methanosarcina thermophila [TaxId: 2210]}
mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
gtshkyvaeraalmlgk

Timeline for d1tuyb1:

• d1tuyb1 first appeared in SCOP 1.71
  
• d1tuyb1 appears in SCOPe 2.06
  
• d1tuyb1 appears in the current release, SCOPe 2.08