Lineage for d1ttya_ (1tty A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1985191Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1985225Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1985233Protein Sigma70 (SigA, RpoD) [88666] (4 species)
    Pfam PF03979
  7. 1985239Species Thermotoga maritima [TaxId:2336] [116817] (2 PDB entries)
    Uniprot P77994 313-399
  8. 1985240Domain d1ttya_: 1tty A: [112638]

Details for d1ttya_

PDB Entry: 1tty (more details)

PDB Description: solution structure of sigma a region 4 from thermotoga maritima
PDB Compounds: (A:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d1ttya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttya_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermotoga maritima [TaxId: 2336]}
keamrmlmreelekvlktlspreamvlrmryglldgkpktleevgqyfnvtrerirqiev
kalrklrhpsrskylksllslmdeneg

SCOPe Domain Coordinates for d1ttya_:

Click to download the PDB-style file with coordinates for d1ttya_.
(The format of our PDB-style files is described here.)

Timeline for d1ttya_: