SCOP 1.75: Domain d1tt7e1: 1tt7 E:2-127,E:295-330

Lineage for d1tt7e1 (1tt7 E:2-127,E:295-330)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Hypothetical protein YhfP [117171] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117172] (2 PDB entries)
   Uniprot O07615

8. Domain d1tt7e1: 1tt7 E:2-127,E:295-330 [112631]
   Other proteins in same PDB: d1tt7a2, d1tt7b2, d1tt7c2, d1tt7d2, d1tt7e2, d1tt7f2
   Structural genomics target

Details for d1tt7e1

PDB Entry: 1tt7, 2.7 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp

PDB Compounds: (E:) yhfp

SCOP Domain Sequences for d1tt7e1:

Sequence; same for both SEQRES and ATOM records:

>d1tt7e1 b.35.1.2 (E:2-127,E:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}
stlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivrey
plilgidaagtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnls
lkeamvXdqlltivdrevsleetpgalkdilqnriqgrvivkl

Timeline for d1tt7e1:

• d1tt7e1 first appeared in SCOP 1.71
  
• d1tt7e1 appears in SCOP 1.73
  
• d1tt7e1 appears in SCOPe 2.01
  
• d1tt7e1 appears in the current release, SCOPe 2.08