Lineage for d1tqes_ (1tqe S:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204555Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2204556Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 2204557Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2204570Protein Myocyte enhancer factor Mef2b core [103117] (1 species)
  7. 2204571Species Human (Homo sapiens) [TaxId:9606] [103118] (2 PDB entries)
    Uniprot Q02080 2-91
  8. 2204577Domain d1tqes_: 1tqe S: [112612]
    complexed with Histone deacetylase 9 peptide (Uniprot Q9UKV0 139-155), chains X and Y
    protein/DNA complex

Details for d1tqes_

PDB Entry: 1tqe (more details), 2.7 Å

PDB Description: mechanism of recruitment of class ii histone deacetylases by myocyte enhancer factor-2
PDB Compounds: (S:) Myocyte-specific enhancer factor 2B

SCOPe Domain Sequences for d1tqes_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqes_ d.88.1.1 (S:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
mdrvllkyteysephesrtntdiletlkrr

SCOPe Domain Coordinates for d1tqes_:

Click to download the PDB-style file with coordinates for d1tqes_.
(The format of our PDB-style files is described here.)

Timeline for d1tqes_: