Lineage for d1toza2 (1toz A:453-491)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 622118Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 622119Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 622300Protein Neurogenic locus notch homolog protein 1, Notch1 [118243] (1 species)
  7. 622301Species Human (Homo sapiens) [TaxId:9606] [118244] (1 PDB entry)
  8. 622303Domain d1toza2: 1toz A:453-491 [112606]

Details for d1toza2

PDB Entry: 1toz (more details)

PDB Description: nmr structure of the human notch-1 ligand binding region

SCOP Domain Sequences for d1toza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1toza2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens)}
vnecvsnpcqndatcldqigefqcicmpgyegvhcevnt

SCOP Domain Coordinates for d1toza2:

Click to download the PDB-style file with coordinates for d1toza2.
(The format of our PDB-style files is described here.)

Timeline for d1toza2: