Lineage for d1toza2 (1toz A:453-491)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. Protein Neurogenic locus notch homolog protein 1, Notch1 [118243] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [118244] (1 PDB entry)
    Uniprot P46531 411-526
  8. 3031528Domain d1toza2: 1toz A:453-491 [112606]

Details for d1toza2

PDB Entry: 1toz (more details)

PDB Description: nmr structure of the human notch-1 ligand binding region
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d1toza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1toza2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}
vnecvsnpcqndatcldqigefqcicmpgyegvhcevnt

SCOPe Domain Coordinates for d1toza2:

Click to download the PDB-style file with coordinates for d1toza2.
(The format of our PDB-style files is described here.)

Timeline for d1toza2: