Lineage for d1tm3i_ (1tm3 I:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024403Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1024404Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1024405Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
  6. 1024406Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 1024407Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. 1024414Domain d1tm3i_: 1tm3 I: [112512]
    Other proteins in same PDB: d1tm3e_
    complexed with 1pe, ca, cit, na; mutant

Details for d1tm3i_

PDB Entry: 1tm3 (more details), 1.57 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59k mutant
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1tm3i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tm3i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtkeyridrvrlfvdrldniaqv
prvg

SCOPe Domain Coordinates for d1tm3i_:

Click to download the PDB-style file with coordinates for d1tm3i_.
(The format of our PDB-style files is described here.)

Timeline for d1tm3i_: