Lineage for d1tlhb_ (1tlh B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260831Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1260839Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 1260840Species Escherichia coli [TaxId:562] [116816] (2 PDB entries)
    Uniprot P00579 546-613
  8. 1260842Domain d1tlhb_: 1tlh B: [112507]
    Other proteins in same PDB: d1tlha_
    sigma4 region only

Details for d1tlhb_

PDB Entry: 1tlh (more details)

PDB Description: T4 AsiA bound to sigma70 region 4
PDB Compounds: (B:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d1tlhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlhb_ a.4.13.2 (B:) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]}
dvlagltareakvlrmrfgidmntdytleevgkqfdvtrerirqieakalrklrhpsrse
vlrsfldd

SCOPe Domain Coordinates for d1tlhb_:

Click to download the PDB-style file with coordinates for d1tlhb_.
(The format of our PDB-style files is described here.)

Timeline for d1tlhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tlha_