Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
Protein Sigma70 (SigA, RpoD) [88666] (4 species) Pfam PF03979 |
Species Escherichia coli [TaxId:562] [419561] (3 PDB entries) Uniprot P00579 546-613 |
Domain d1tlhb_: 1tlh B: [112507] Other proteins in same PDB: d1tlha_ sigma4 region only |
PDB Entry: 1tlh (more details)
SCOPe Domain Sequences for d1tlhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlhb_ a.4.13.2 (B:) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} dvlagltareakvlrmrfgidmntdytleevgkqfdvtrerirqieakalrklrhpsrse vlrsfldd
Timeline for d1tlhb_: