SCOP 1.73: Domain d1tkod_: 1tko D:

Lineage for d1tkod_ (1tko D:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (9 proteins)

6. Protein Dodecameric ferritin homolog [47250] (13 species)

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)

8. Domain d1tkod_: 1tko D: [112477]
   complexed with fe, na, so4

Details for d1tkod_

PDB Entry: 1tko, 2.9 Å

PDB Description: iron-oxo clusters biomineralizing on protein surfaces. structural analysis of h.salinarum dpsa in its low and high iron states

PDB Compounds: (D:) Iron-rich dpsA-homolog protein

SCOP Domain Sequences for d1tkod_:

Sequence; same for both SEQRES and ATOM records:

>d1tkod_ a.25.1.1 (D:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

Timeline for d1tkod_:

• d1tkod_ first appeared in SCOP 1.71
  
• d1tkod_ appears in SCOP 1.75
  
• d1tkod_ appears in the current release, SCOPe 2.08