SCOP 1.73: Domain d1tkga1: 1tkg A:1-62

Lineage for d1tkga1 (1tkg A:1-62)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.10: TGS-like [81271] (2 families)
   possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif

5. Family d.15.10.1: TGS domain [81270] (1 protein)

6. Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)

7. Species Escherichia coli [TaxId:562] [55177] (5 PDB entries)

8. Domain d1tkga1: 1tkg A:1-62 [112472]
   Other proteins in same PDB: d1tkga2
   complexed with ssa

Details for d1tkga1

PDB Entry: 1tkg, 1.5 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with an analog of seryladenylate

PDB Compounds: (A:) threonyl-tRNA synthetase

SCOP Domain Sequences for d1tkga1:

Sequence; same for both SEQRES and ATOM records:

>d1tkga1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]}
mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
ta

Timeline for d1tkga1:

• d1tkga1 first appeared in SCOP 1.71
  
• d1tkga1 appears in SCOP 1.75
  
• d1tkga1 appears in the current release, SCOPe 2.08