Lineage for d1tkga1 (1tkg A:1-62)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 599391Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 599392Family d.15.10.1: TGS domain [81270] (1 protein)
  6. 599393Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)
  7. 599394Species Escherichia coli [TaxId:562] [55177] (5 PDB entries)
  8. 599398Domain d1tkga1: 1tkg A:1-62 [112472]
    Other proteins in same PDB: d1tkga2
    complexed with ssa

Details for d1tkga1

PDB Entry: 1tkg (more details), 1.5 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with an analog of seryladenylate

SCOP Domain Sequences for d1tkga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkga1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli}
mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
ta

SCOP Domain Coordinates for d1tkga1:

Click to download the PDB-style file with coordinates for d1tkga1.
(The format of our PDB-style files is described here.)

Timeline for d1tkga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tkga2