![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptogamin I [49576] (2 species) duplication: contains tandem repeat of two similar domains |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries) Uniprot P21707 271-419 ! Uniprot P21707 271-419 |
![]() | Domain d1tjxa_: 1tjx A: [112465] complexed with act, ca, gol |
PDB Entry: 1tjx (more details), 1.04 Å
SCOPe Domain Sequences for d1tjxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjxa_ b.7.1.2 (A:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]} sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav
Timeline for d1tjxa_: