SCOPe 2.03: Domain d1tjxa_: 1tjx A:

Lineage for d1tjxa_ (1tjx A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (2 species)
   duplication: contains tandem repeat of two similar domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries)
   Uniprot P21707 271-419 ! Uniprot P21707 271-419

8. Domain d1tjxa_: 1tjx A: [112465]
   complexed with act, ca, gol

Details for d1tjxa_

PDB Entry: 1tjx, 1.04 Å

PDB Description: Crystallographic Identification of Ca2+ Coordination Sites in Synaptotagmin I C2B Domain

PDB Compounds: (A:) similar to synaptotagminI/p65

SCOPe Domain Sequences for d1tjxa_:

Sequence; same for both SEQRES and ATOM records:

>d1tjxa_ b.7.1.2 (A:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav

Timeline for d1tjxa_:

• d1tjxa_ first appeared in SCOP 1.71
  
• d1tjxa_ appears in SCOPe 2.02
  
• d1tjxa_ appears in SCOPe 2.04
  
• d1tjxa_ appears in the current release, SCOPe 2.08, called d1tjxa1