Lineage for d1tjoa_ (1tjo A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536144Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 536152Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
  8. 536153Domain d1tjoa_: 1tjo A: [112461]

Details for d1tjoa_

PDB Entry: 1tjo (more details), 1.6 Å

PDB Description: iron-oxo clusters biomineralizing on protein surfaces. structural analysis of h.salinarum dpsa in its low and high iron states

SCOP Domain Sequences for d1tjoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjoa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum}
stqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefr
dlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslan
dmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

SCOP Domain Coordinates for d1tjoa_:

Click to download the PDB-style file with coordinates for d1tjoa_.
(The format of our PDB-style files is described here.)

Timeline for d1tjoa_: