![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (3 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (7 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (10 species) |
![]() | Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries) |
![]() | Domain d1tjoa_: 1tjo A: [112461] |
PDB Entry: 1tjo (more details), 1.6 Å
SCOP Domain Sequences for d1tjoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjoa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum} stqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefr dlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslan dmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
Timeline for d1tjoa_: